fastapi-clean-architecture

Community

Build scalable FastAPI backends, effortlessly.

Authorrafaelkamimura
Version1.0.0
Installs0

System Documentation

What problem does it solve?

This Skill provides a structured approach to building FastAPI applications using Clean Architecture, solving problems of maintainability, testability, and scalability by enforcing clear separation of concerns and robust dependency management. It helps developers create enterprise-grade backend services that are easy to evolve and debug.

Core Features & Use Cases

  • Three-Layer Architecture: Organizes code into API, Domain, and Infrastructure layers, ensuring clear responsibilities and preventing tight coupling.
  • Dependency Injection Container: Utilizes dependency-injector to manage and inject dependencies, making components easily swappable and testable.
  • Repository & Service Patterns: Implements abstract interfaces for data access and business logic in the domain, with concrete implementations in the infrastructure, promoting a clean separation from persistence details.
  • Comprehensive Testing Strategy: Guides on unit, service, and integration testing, ensuring high code quality and reliability across all layers.
  • Use Case: Design and implement a new microservice for user management, ensuring it adheres to enterprise-grade architectural standards, is fully testable, and can easily integrate with different databases or external services without major refactoring.

Quick Start

Generate a new FastAPI project structure following Clean Architecture, including src/api, src/domain, src/infra directories, and a basic user module with repository and service interfaces.

Dependency Matrix

Required Modules

fastapisqlalchemypydanticdependency-injectoruvicorn

Components

Standard package

💻 Claude Code Installation

Recommended: Let Claude install automatically. Simply copy and paste the text below to Claude Code.

Please help me install this Skill:
Name: fastapi-clean-architecture
Download link: https://github.com/rafaelkamimura/claude-config/archive/main.zip#fastapi-clean-architecture

Please download this .zip file, extract it, and install it in the .claude/skills/ directory.
View Source Repository

Agent Skills Search Helper

Install a tiny helper to your Agent, search and equip skill from 471,000+ vetted skills library on demand.