What problem does it solve?
A peptide can show a clear phenotype yet fail to bind its hypothesized target, leaving researchers guessing which protein it actually engages. This Skill deorphanizes peptides by combining sequence, motif, homology, target-family, phenotype, and cross-species evidence to rank the most likely real targets instead of relying on name-level assumptions.
Core Features & Use Cases
- Multi-route candidate generation: Unions BLAST homology, PROSITE/ELM motif signatures, HGNC/InterPro/GPCRdb target-family enumeration, and OpenTargets phenotype anchoring into one ranked shortlist.
- Target-class router: Classifies the peptide (GPCR ligand, ion-channel toxin, protease target, cytokine receptor, integrin ligand, and more) so enumeration adapts to any target class, not just GPCRs.
- Cross-species reconciliation: Aligns human, assay-species, and source-species ortholog sequences to explain "binds in species A but not B" results, plus DPP4/protease liability flags.
- Optional structural confirmation: Co-folds the peptide against shortlisted receptors via NVIDIA NIM (Boltz2, AlphaFold2-Multimer, OpenFold3) ranked by interface ipTM, with a keyless dry-run mode.
- Use Case: Given exendin-4 with a negative GLP1R binding result and a type 2 diabetes phenotype, the pipeline recovers the class-B GPCR panel and promotes GIPR to Tier 1 as the leading real-target hypothesis, with zero API keys.
Quick Start
Run the deorphanization pipeline on my peptide sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS with hypothesized target GLP1R and phenotype type 2 diabetes mellitus to find its real target.