tooluniverse-peptide-target-deorphanization

Identify the real protein targets of a peptide from its sequence and phenotype.

1.7k|254|Updated Mar 3, 2025
One-click install
npx skills add https://github.com/mims-harvard/ToolUniverse --skill tooluniverse-peptide-target-deorphanization
Or copy as Structured Prompt for Agent
Please help me install this Agent Skill.
Skill: tooluniverse-peptide-target-deorphanization
Source: https://github.com/mims-harvard/ToolUniverse/tree/main/plugins/tooluniverse/skills/tooluniverse-peptide-target-deorphanization
Command: npx skills add https://github.com/mims-harvard/ToolUniverse --skill tooluniverse-peptide-target-deorphanization

SYSTEM DOCUMENTATION & REQUIREMENTS

💡 This Skill requires tooluniverse, and includes scripts (resource) and references (resource) components.

What problem does it solve?

A peptide can show a clear phenotype yet fail to bind its hypothesized target, leaving researchers guessing which protein it actually engages. This Skill deorphanizes peptides by combining sequence, motif, homology, target-family, phenotype, and cross-species evidence to rank the most likely real targets instead of relying on name-level assumptions.

Core Features & Use Cases

  • Multi-route candidate generation: Unions BLAST homology, PROSITE/ELM motif signatures, HGNC/InterPro/GPCRdb target-family enumeration, and OpenTargets phenotype anchoring into one ranked shortlist.
  • Target-class router: Classifies the peptide (GPCR ligand, ion-channel toxin, protease target, cytokine receptor, integrin ligand, and more) so enumeration adapts to any target class, not just GPCRs.
  • Cross-species reconciliation: Aligns human, assay-species, and source-species ortholog sequences to explain "binds in species A but not B" results, plus DPP4/protease liability flags.
  • Optional structural confirmation: Co-folds the peptide against shortlisted receptors via NVIDIA NIM (Boltz2, AlphaFold2-Multimer, OpenFold3) ranked by interface ipTM, with a keyless dry-run mode.
  • Use Case: Given exendin-4 with a negative GLP1R binding result and a type 2 diabetes phenotype, the pipeline recovers the class-B GPCR panel and promotes GIPR to Tier 1 as the leading real-target hypothesis, with zero API keys.

Quick Start

Run the deorphanization pipeline on my peptide sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS with hypothesized target GLP1R and phenotype type 2 diabetes mellitus to find its real target.

Frequently Asked Questions about tooluniverse-peptide-target-deorphanization

High-intent search queries and answers about installing and using this skill.

FAQPage Schema
How do I find the real target of a peptide that does not bind its hypothesized receptor?

Run deorphanize_peptide.py with the peptide sequence, the hypothesized target gene, and the disease phenotype. It unions homology, motif, target-family, and OpenTargets phenotype evidence into a ranked candidate shortlist, promoting paralogs and phenotype-shared receptors when the hypothesized target tests negative.

Can peptide target deorphanization work for non-GPCR targets like ion channels or proteases?

Yes. A target-class router classifies the peptide as a GPCR ligand, ion-channel toxin, protease substrate, cytokine, integrin ligand, or other class, then adapts family enumeration using HGNC gene families and InterPro, which work for any target class. GPCRdb is only a GPCR-specific cross-check.

Does the deorphanization pipeline require an API key?

No key is needed for candidate generation and ranking, which use keyless tools like BLAST, PROSITE, HGNC, OpenTargets, and UniProt. Only the optional Phase 5 co-folding confirmation requires NVIDIA_API_KEY, and cofold_screen.py runs a dry run without it.

Why does my peptide bind in one species but not another?

Species-specific binding usually reflects divergence in the receptor's ligand-binding interface, not a different target. The pipeline resolves human, assay-species, and source-species ortholog sequences via UniProt and aligns them, reporting percent identity to flag the diverged ortholog.

What are the limitations of sequence-based peptide target prediction?

BLAST, PROSITE, and ProtParam assume canonical linear peptides, so non-ribosomal or cyclic peptides may be mischaracterized and should be checked with Norine and co-folded with the cyclic flag. Single-route candidates remain Tier 3 hypotheses until corroborated by phenotype or structural evidence.