esm-protein-language-model

Generate protein sequences, predict structures, and create embeddings with ESM models.

298|27|Updated Feb 18, 2026
One-click install
npx skills add https://github.com/jaechang-hits/SciAgent-Skills --skill esm-protein-language-model
Or copy as Structured Prompt for Agent
Please help me install this Agent Skill.
Skill: esm-protein-language-model
Source: https://github.com/jaechang-hits/SciAgent-Skills/tree/main/skills/proteomics-protein-engineering/esm-protein-language-model
Command: npx skills add https://github.com/jaechang-hits/SciAgent-Skills --skill esm-protein-language-model

SYSTEM DOCUMENTATION & REQUIREMENTS

💡 This Skill requires esm, and includes scripts (resource) and references (resource) components.

What problem does it solve?

This Skill enables the design of novel proteins, prediction of their structures, and extraction of meaningful representations for machine learning tasks, streamlining protein engineering and discovery workflows.

Core Features & Use Cases

  • Protein Sequence Generation: Create new protein sequences with desired functions or structures.
  • Structure Prediction: Predict the 3D atomic coordinates of a protein from its amino acid sequence.
  • Inverse Folding: Design amino acid sequences that will fold into a specific target 3D structure.
  • Protein Embeddings: Generate fixed-length vector representations of proteins for downstream machine learning tasks like classification or clustering.
  • Use Case: A researcher wants to design a new enzyme with a specific catalytic activity. They can use this Skill to generate candidate sequences, predict their structures, and then use the embeddings to cluster similar designs.

Quick Start

Use the esm-protein-language-model skill to generate a protein sequence for the provided amino acid sequence "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKRQQIAATGFHIIPGDKPDNRAGGYDN".

Frequently Asked Questions about esm-protein-language-model

High-intent search queries and answers about installing and using this skill.

FAQPage Schema
How do I design a novel protein sequence with a specific function?

To design a novel protein sequence, you can use the ESM3 and ESM C protein language models to generate candidate amino acid sequences tailored to desired structural or functional properties for de novo protein design.

Can I predict protein 3D atomic structure from an amino acid sequence?

Yes, you can predict protein 3D atomic structure from an amino acid sequence. The ESM protein language models infer atomic-level 3D coordinates directly from the provided sequence inputs.

Do I need a local GPU to run protein language model inference?

You need either a local GPU or the EvolutionaryScale Forge cloud API to run protein language model inference. These computational resources are required to execute the ESM3 and ESM C model operations.

What is inverse folding in protein design?

Inverse folding in protein design is the process of designing amino acid sequences that will fold into a specific target 3D structure. This Skill uses ESM models to generate sequences matching your structural constraints.

How do I generate protein embeddings for machine learning?

To generate protein embeddings for machine learning, the Skill uses ESM models to create fixed-length vector representations of protein sequences. These embeddings facilitate downstream tasks like classification and clustering.

What's the best way to cluster similar designed protein structures?

The best way to cluster similar designed protein structures is to generate fixed-length protein embeddings using the ESM models. You can then apply standard machine learning clustering algorithms to these vector representations.