tooluniverse-protein-structure-prediction

Predicts protein 3D structures from sequence using ESMFold, AlphaFold, and RCSB experimental data.

1.7k|254|Updated Mar 3, 2025
One-click install
npx skills add https://github.com/mims-harvard/ToolUniverse --skill tooluniverse-protein-structure-prediction
Or copy as Structured Prompt for Agent
Please help me install this Agent Skill.
Skill: tooluniverse-protein-structure-prediction
Source: https://github.com/mims-harvard/ToolUniverse/tree/main/plugins/tooluniverse/skills/tooluniverse-protein-structure-prediction
Command: npx skills add https://github.com/mims-harvard/ToolUniverse --skill tooluniverse-protein-structure-prediction

SYSTEM DOCUMENTATION & REQUIREMENTS

What problem does it solve?

Researchers often need a 3D protein structure when no experimental structure exists, and manually coordinating prediction tools, confidence scoring, and variant analysis is slow and error-prone. This Skill runs an end-to-end workflow that predicts structures from sequence, benchmarks them against experimental data, and interprets variant impact.

Core Features & Use Cases

  • De Novo Structure Prediction: Runs ESMFold on any amino acid sequence (up to ~800 residues) and reports per-residue pLDDT and pTM confidence scores.
  • AlphaFold & Experimental Comparison: Retrieves precomputed AlphaFold models by UniProt accession and searches RCSB PDB for experimental structures to validate predictions.
  • Variant Impact Assessment: Uses ProtVar to map mutations like "P04637 R175H" to structural and functional context, with tiered evidence grading.
  • Use Case: Given a novel protein sequence, the Skill computes physicochemical properties with ProtParam, predicts the fold with ESMFold, cross-checks against AlphaFold and PDB, and delivers a structured report with confidence maps and recommendations.

Quick Start

Predict the structure of this protein sequence and tell me which regions are low confidence: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH.

Frequently Asked Questions about tooluniverse-protein-structure-prediction

High-intent search queries and answers about installing and using this skill.

FAQPage Schema
How do I predict a protein structure from an amino acid sequence?

Provide the single-letter amino acid sequence to ESMFold_predict_structure, which returns a PDB-format structure with per-residue pLDDT confidence scores and a pTM global fold score. Sequences up to about 800 residues are supported.

ESMFold vs AlphaFold: which should I use for structure prediction?

ESMFold works directly on any sequence without a database lookup and is faster for novel proteins. AlphaFold uses multiple sequence alignments and typically gives higher accuracy for well-conserved proteins with a UniProt accession, so use it as the reference when available.

What does a pLDDT score below 50 mean in AlphaFold predictions?

A pLDDT below 50 indicates very low confidence, usually corresponding to intrinsically disordered regions rather than a folded structure. These regions should not be interpreted as having a defined 3D conformation.

Can ESMFold predict structures for sequences longer than 800 residues?

Sequences over roughly 800 residues may fail or produce lower-quality predictions with ESMFold. The recommended fallback is to retrieve the precomputed AlphaFold model using the protein's UniProt accession instead.

How do I assess whether a mutation affects protein structure?

Use ProtVar_map_variant with notation like "P04637 R175H" to resolve the position, then ProtVar_get_function to get domain context, conservation, and pathogenicity predictions. Residues in active sites or buried hydrophobic cores typically have higher structural impact.

Can this workflow predict protein complexes or multimers?

No, both ESMFold and standard AlphaFold predict single-chain monomer structures only. Complex prediction requires AlphaFold-Multimer, which is not available through these tools.