What problem does it solve?
Researchers often need a 3D protein structure when no experimental structure exists, and manually coordinating prediction tools, confidence scoring, and variant analysis is slow and error-prone. This Skill runs an end-to-end workflow that predicts structures from sequence, benchmarks them against experimental data, and interprets variant impact.
Core Features & Use Cases
- De Novo Structure Prediction: Runs ESMFold on any amino acid sequence (up to ~800 residues) and reports per-residue pLDDT and pTM confidence scores.
- AlphaFold & Experimental Comparison: Retrieves precomputed AlphaFold models by UniProt accession and searches RCSB PDB for experimental structures to validate predictions.
- Variant Impact Assessment: Uses ProtVar to map mutations like "P04637 R175H" to structural and functional context, with tiered evidence grading.
- Use Case: Given a novel protein sequence, the Skill computes physicochemical properties with ProtParam, predicts the fold with ESMFold, cross-checks against AlphaFold and PDB, and delivers a structured report with confidence maps and recommendations.
Quick Start
Predict the structure of this protein sequence and tell me which regions are low confidence: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH.