protein-language-models
CommunityPredict protein structures and mutations with leading protein language models.
Education & Research#protein language models#mutation analysis#protein structure prediction#AI in biology#machine learning in bioinformatics
Authorpradyumnasagar
Version1.0.0
Installs0
System Documentation
What problem does it solve?
This Skill solves the problem of predicting protein structures and mutations, allowing users to quickly assess protein variants without having to rely on time-consuming wet-lab experiments.
Core Features & Use Cases
- Protein Structure Prediction: Generate 3D protein structures from amino acid sequences.
- Mutation Effect Prediction: Assess the impact of mutations on protein structures and functions.
- Use Case: Imagine you have a protein of interest and you want to understand how a specific mutation might affect its structure and function. Use this Skill to predict the structure and analyze the mutation's effects.
Quick Start
Use the protein-language-models skill to predict the structure of the protein sequence 'MKKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDALTGWVEYPLVLEWR'.
Dependency Matrix
Required Modules
torchtransformersfair-esmbiotitepy3Dmolboltzmmseqs2
Components
scriptsreferencesassets
💻 Claude Code Installation
Recommended: Let Claude install automatically. Simply copy and paste the text below to Claude Code.
Please help me install this Skill: Name: protein-language-models Download link: https://github.com/pradyumnasagar/open-research-skills/archive/main.zip#protein-language-models Please download this .zip file, extract it, and install it in the .claude/skills/ directory.
Agent Skills Search Helper
Install a tiny helper to your Agent, search and equip skill from 620,000+ vetted skills library on demand.